Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GZMBL2 Peptide - middle region

GZMBL2 Peptide - middle region

Product Specifications

UniProt

P18291

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_612526.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IMDEYSGSKKCGGFLIREDFVLTAAHCSGSKINVTLGAHNIKEQEKMQQII

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TDP43 antibody
E19-2968-2 100 µg -100 µL

TDP43 antibody

Sign In for Pricing
View Details
GABRR2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0830606 1.0 µg DNA

GABRR2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
CaMK2a Antibody Blocking Peptide
orb1516131 500 µg

CaMK2a Antibody Blocking Peptide

Sign In for Pricing
View Details
AF647 Anti-Mouse CD45R/B220 Antibody
RD21372F-01 50 Tests

AF647 Anti-Mouse CD45R/B220 Antibody

Sign In for Pricing
View Details
AF647 Anti-Mouse CD45R/B220 Antibody
RD21372F-02 100 Tests

AF647 Anti-Mouse CD45R/B220 Antibody

Sign In for Pricing
View Details
AF647 Anti-Mouse CD45R/B220 Antibody
RD21372F-03 2x 100 Tests

AF647 Anti-Mouse CD45R/B220 Antibody

Sign In for Pricing
View Details