What is the catalog number for GZMBL2 Peptide - middle region?

The catalog number for GZMBL2 Peptide - middle region is orb1998148.

What sizes are available for GZMBL2 Peptide - middle region?

GZMBL2 Peptide - middle region is available in the following size(s): 100 µg.

Is GZMBL2 Peptide - middle region in stock?

GZMBL2 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

GZMBL2 Peptide - middle region

Product Specifications

UniProt

P18291

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_612526.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IMDEYSGSKKCGGFLIREDFVLTAAHCSGSKINVTLGAHNIKEQEKMQQII

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E28M0011 100 µL

PFKFB3 (11D8) Rabbit Monoclonal Antibody

Sign In for Pricing

View Details

MBS1481495-01 0.02 mg (E-Coli)

Recombinant Helicobacter acinonychis Aliphatic amidase (amiE)

Sign In for Pricing

View Details

MBS1481495-02 0.02 mg (Yeast)

Recombinant Helicobacter acinonychis Aliphatic amidase (amiE)

Sign In for Pricing

View Details

MBS1481495-03 0.1 mg (E-Coli)

Recombinant Helicobacter acinonychis Aliphatic amidase (amiE)

Sign In for Pricing

View Details

MBS1481495-04 0.1 mg (Yeast)

Recombinant Helicobacter acinonychis Aliphatic amidase (amiE)

Sign In for Pricing

View Details

MBS1481495-05 0.02 mg (Baculovirus)

Recombinant Helicobacter acinonychis Aliphatic amidase (amiE)

Sign In for Pricing

View Details