Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDE1B Peptide - middle region

PDE1B Peptide - middle region

Product Specifications

Product Name Alternative

Pde1b1

UniProt

Q01065

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_032826.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PTVFLMSFLEALETGYGKYKNPYHNQIHAADVTQTVHCFLLRTGMVHCLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL-5 Protein, Mouse, Recombinant (His Tag)
PM53201I2-01 20 µg

IL-5 Protein, Mouse, Recombinant (His Tag)

Sign In for Pricing
View Details
IL-5 Protein, Mouse, Recombinant (His Tag)
PM53201I2-02 100 µg

IL-5 Protein, Mouse, Recombinant (His Tag)

Sign In for Pricing
View Details
IL-5 Protein, Mouse, Recombinant (His Tag)
PM53201I2-03 1 mg

IL-5 Protein, Mouse, Recombinant (His Tag)

Sign In for Pricing
View Details
ABHD5 Peptide
orb2016745 100 µg

ABHD5 Peptide

Sign In for Pricing
View Details
ULK2, ID (S323) (ULK2, KIAA0623, Serine/threonine-protein kinase ULK2, Unc-51-like kinase 2) (APC) discontinued
043600-APC 200 µL

ULK2, ID (S323) (ULK2, KIAA0623, Serine/threonine-protein kinase ULK2, Unc-51-like kinase 2) (APC) discontinued

Sign In for Pricing
View Details
LM10
S8368-200mg 200 mg

LM10

Sign In for Pricing
View Details