Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDE1B Peptide - middle region

PDE1B Peptide - middle region

Product Specifications

Product Name Alternative

Pde1b1

UniProt

Q01065

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_032826.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PTVFLMSFLEALETGYGKYKNPYHNQIHAADVTQTVHCFLLRTGMVHCLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human GFM1 Protein, N-His
orb2833032-01 20 µg

Recombinant Human GFM1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human GFM1 Protein, N-His
orb2833032-02 50 µg

Recombinant Human GFM1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human GFM1 Protein, N-His
orb2833032-03 100 µg

Recombinant Human GFM1 Protein, N-His

Sign In for Pricing
View Details
FRMPD4 Human Over-expression Lysate
orb1368473 20 µg

FRMPD4 Human Over-expression Lysate

Sign In for Pricing
View Details
Tifencillin potassium
T202152-01 10 mg

Tifencillin potassium

Sign In for Pricing
View Details
Tifencillin potassium
T202152-02 50 mg

Tifencillin potassium

Sign In for Pricing
View Details