OASL2 Peptide - middle region
OASL2 Peptide - middle region
Product Specifications
Product Name Alternative
Oasl, M1204, Mmu-OASL
UniProt
Q5MYT9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_035984.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VRNFLKKQLKGDRPIILDPADPTNNLGRRKGWEQVAAEAAFCLLQVCCTT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
NBP2-70417 100 µg
Mouse Monoclonal AP2M1 Antibody (OTI1E9) - Azide and BSA Free
Sign In for Pricing
View Details 
19162151 3x 1.0 µg DNA
EIF4E2P1 CRISPR All-in-one AAV vector set (with saCas9)(Human)
Sign In for Pricing
View Details MBS8100604-02 5x 0.1 mL
Anti-CHOP/DDIT3 Antibody, Rabbit Polyclonal
Sign In for Pricing
View Details