Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OASL2 Peptide - middle region

OASL2 Peptide - middle region

Product Specifications

Product Name Alternative

Oasl, M1204, Mmu-OASL

UniProt

Q5MYT9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_035984.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VRNFLKKQLKGDRPIILDPADPTNNLGRRKGWEQVAAEAAFCLLQVCCTT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse CYP8B1 (7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase) ELISA Kit
EM2136 96 Tests

Mouse CYP8B1 (7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase) ELISA Kit

Sign In for Pricing
View Details
Recombinant Mast Cell Chymase Antibody
RC-15002-01 50 μL

Recombinant Mast Cell Chymase Antibody

Sign In for Pricing
View Details
Recombinant Mast Cell Chymase Antibody
RC-15002-02 100 µL

Recombinant Mast Cell Chymase Antibody

Sign In for Pricing
View Details
Recombinant Mast Cell Chymase Antibody
RC-15002-03 1 mL

Recombinant Mast Cell Chymase Antibody

Sign In for Pricing
View Details
PtdIns- (4,5) -P2-biotin trisodium
orb3174463-01 50 mg

PtdIns- (4,5) -P2-biotin trisodium

Sign In for Pricing
View Details
PtdIns- (4,5) -P2-biotin trisodium
orb3174463-02 10 mg

PtdIns- (4,5) -P2-biotin trisodium

Sign In for Pricing
View Details