Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANO7 Peptide - middle region

ANO7 Peptide - middle region

Product Specifications

Product Name Alternative

Ngep, Ngep-L, Pcanap5, Tmem16g

UniProt

Q6IFT6

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001258813.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EHVPDTPPEYYSCQFKASKLQWFLGSDNQDTFFTSTKRHQILFEILAKTP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

hsa-miR-2682-5p miRNA Antagomir
MBS8316830-01 10 nmol

hsa-miR-2682-5p miRNA Antagomir

Sign In for Pricing
View Details
hsa-miR-2682-5p miRNA Antagomir
MBS8316830-02 20 nmol

hsa-miR-2682-5p miRNA Antagomir

Sign In for Pricing
View Details
hsa-miR-2682-5p miRNA Antagomir
MBS8316830-03 5x 20 nmol

hsa-miR-2682-5p miRNA Antagomir

Sign In for Pricing
View Details
OAZ1 Rabbit Polyclonal Antibody
TA379437 100 µL

OAZ1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
POLDIP2 Rabbit mAb Antibody
orb3014982 100 µL

POLDIP2 Rabbit mAb Antibody

Sign In for Pricing
View Details
Recombinant Human 15-PGDH/HPGD (C-6His)
C848-1mg 1 mg

Recombinant Human 15-PGDH/HPGD (C-6His)

Sign In for Pricing
View Details