ANO7 Peptide - middle region
ANO7 Peptide - middle region
Product Specifications
Product Name Alternative
Ngep, Ngep-L, Pcanap5, Tmem16g
UniProt
Q6IFT6
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001258813.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EHVPDTPPEYYSCQFKASKLQWFLGSDNQDTFFTSTKRHQILFEILAKTP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K0849303 1.0 µg DNA
GDF3 sgRNA CRISPR Lentivector (Human) (Target 2)
Sign In for Pricing
View Details 
039112-FITC 200 µL
NR1D1, ID (NR1D1, EAR1, HREV, THRAL, Nuclear receptor subfamily 1 group D member 1, Rev-erbA-alpha, V-erbA-related protein 1) (FITC) discontinued
Sign In for Pricing
View Details 30756114 3x 1.0 µg
Msra sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
Sign In for Pricing
View Details 
37136066 1.0 µg DNA
PODXL2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
Sign In for Pricing
View Details 