Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNJ14 Peptide - middle region

KCNJ14 Peptide - middle region

Product Specifications

Product Name Alternative

Kir2.4

UniProt

O70596

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_733836

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YIPLDHQDVDVGFDGGTDRIFLVSPITIVHEIDSASPLYELGRAELARADF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phosphate Buffered Saline plus Tween 20 (10x) pH 7.4
PBE999 1000 mL

Phosphate Buffered Saline plus Tween 20 (10x) pH 7.4

Sign In for Pricing
View Details
CST9L ORF Vector (Human) (pORF)
ORF002748 1.0 µg DNA

CST9L ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Pig PTGDS / Prostaglandin-H2 D-isomerase Recombinant Protein
R0167p 1 Each

Pig PTGDS / Prostaglandin-H2 D-isomerase Recombinant Protein

Sign In for Pricing
View Details
TSPAN5 siRNA (Mouse)
orb1843599-01 15 nmol

TSPAN5 siRNA (Mouse)

Sign In for Pricing
View Details
TSPAN5 siRNA (Mouse)
orb1843599-02 30 nmol

TSPAN5 siRNA (Mouse)

Sign In for Pricing
View Details
SERPINE1 (PAI1, PLANH1, Plasminogen Activator Inhibitor 1, Endothelial Plasminogen Activator Inhibitor, Serpin E1, PAI-1) (MaxLight 490)
133188-ML490 100 µL

SERPINE1 (PAI1, PLANH1, Plasminogen Activator Inhibitor 1, Endothelial Plasminogen Activator Inhibitor, Serpin E1, PAI-1) (MaxLight 490)

Sign In for Pricing
View Details