Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNJ14 Peptide - middle region

KCNJ14 Peptide - middle region

Product Specifications

Product Name Alternative

Kir2.4

UniProt

O70596

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_733836

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YIPLDHQDVDVGFDGGTDRIFLVSPITIVHEIDSASPLYELGRAELARADF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC729501 shRNA Plasmid (h)
sc-75641-SH 20 µg

LOC729501 shRNA Plasmid (h)

Sign In for Pricing
View Details
Phospho-4E-BP1 (Thr37/46) (236B4) Rabbit Monoclonal Antibody (InTraSeq™ 3' Conjugate 3021)
CST 45003S 25 µL

Phospho-4E-BP1 (Thr37/46) (236B4) Rabbit Monoclonal Antibody (InTraSeq™ 3' Conjugate 3021)

Sign In for Pricing
View Details
Melengestrol acetate
orb1688173-01 50 mg

Melengestrol acetate

Sign In for Pricing
View Details
Melengestrol acetate
orb1688173-02 100 mg

Melengestrol acetate

Sign In for Pricing
View Details
Melengestrol acetate
orb1688173-03 1 ml x 10 mM (in DMSO)

Melengestrol acetate

Sign In for Pricing
View Details
IGJ-set siRNA/shRNA/RNAi Lentivector (Human)
24559091 4x 500 ng

IGJ-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details