Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAAR3 Peptide - middle region

TAAR3 Peptide - middle region

Product Specifications

UniProt

Q5QD24

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001008429.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GKNLSKKKDRKAAKTLGIVMGVFLACWLPCFLAVLIDPYLDYSTPIIVLD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EGFR (Epidermal Growth Factor Receptor) (GFR/2968R), CF488A conjugate, 0.1mg/mL
BNC882968-100 1x 100 µL

EGFR (Epidermal Growth Factor Receptor) (GFR/2968R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MS-275
SIH-416-1MG 1 mg

MS-275

Sign In for Pricing
View Details
Barium Hydroxide Octahydrate
TRC-B129000-5G 5 g

Barium Hydroxide Octahydrate

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS800424 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
FKBP51 (FKBP5) (NM_004117) Human Over-expression Lysate
LY401331 100 µg

FKBP51 (FKBP5) (NM_004117) Human Over-expression Lysate

Sign In for Pricing
View Details
RENBP Polyclonal Antibody
E-AB-90036-01 60 µL

RENBP Polyclonal Antibody

Sign In for Pricing
View Details