Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAAR3 Peptide - middle region

TAAR3 Peptide - middle region

Product Specifications

UniProt

Q5QD24

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001008429.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GKNLSKKKDRKAAKTLGIVMGVFLACWLPCFLAVLIDPYLDYSTPIIVLD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SFTA2 activation kit by CRISPRa
GA118049 1 Kit

Human SFTA2 activation kit by CRISPRa

Sign In for Pricing
View Details
Complement C9 (C9) Rabbit Polyclonal Antibody
TA374166 100 µL

Complement C9 (C9) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PLCG 2 (PLCG2) Rabbit Polyclonal Antibody
AP06406PU-N 100 µg

PLCG 2 (PLCG2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
11beta-Hydroxy-5alpha-Androstane-3,17-dione
TRC-H991110-5MG 5 mg

11beta-Hydroxy-5alpha-Androstane-3,17-dione

Sign In for Pricing
View Details
LRP4 Human Gene Knockout Kit (CRISPR)
KN417609 1 Kit

LRP4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MYL9 Mouse Monoclonal Antibody [Clone ID: OTI3H6]
CF813394 100 µg

MYL9 Mouse Monoclonal Antibody [Clone ID: OTI3H6]

Sign In for Pricing
View Details