Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSSK6 Peptide - middle region

TSSK6 Peptide - middle region

Product Specifications

Product Name Alternative

Sstk, TSK-6, TSSK-6

UniProt

Q925K9

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_114393.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LGIPYDPKKYDVWSLGVVLYVMVTGCMPFDDSDIAGLPRRQKRGVLYPDG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

M-PEG3-phosphonic acid
orb1984371-01 100 mg

M-PEG3-phosphonic acid

Sign In for Pricing
View Details
M-PEG3-phosphonic acid
orb1984371-02 500 mg

M-PEG3-phosphonic acid

Sign In for Pricing
View Details
PEX26 3'UTR Lenti-reporter-Luc Vector
36414081 1.0 µg

PEX26 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Efna1 3'UTR Lenti-reporter-Luc Vector
19014084 1.0 µg

Efna1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
RAB24 Antibody
CSB-PA051869-01 50 μL

RAB24 Antibody

Sign In for Pricing
View Details
RAB24 Antibody
CSB-PA051869-02 100 µL

RAB24 Antibody

Sign In for Pricing
View Details