TSSK6 Peptide - middle region
TSSK6 Peptide - middle region
Product Specifications
Product Name Alternative
Sstk, TSK-6, TSSK-6
UniProt
Q925K9
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_114393.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LGIPYDPKKYDVWSLGVVLYVMVTGCMPFDDSDIAGLPRRQKRGVLYPDG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS454330-01 48 Tests
Human C1q And Tumor Necrosis Factor Related Protein 3 (C1QTNF3) ELISA Kit
Sign In for Pricing
View Details MBS454330-02 96 Tests
Human C1q And Tumor Necrosis Factor Related Protein 3 (C1QTNF3) ELISA Kit
Sign In for Pricing
View Details MBS454330-03 5x 96 Tests
Human C1q And Tumor Necrosis Factor Related Protein 3 (C1QTNF3) ELISA Kit
Sign In for Pricing
View Details MBS454330-04 10x 96 Tests
Human C1q And Tumor Necrosis Factor Related Protein 3 (C1QTNF3) ELISA Kit
Sign In for Pricing
View Details 