Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SUSD4 Peptide - middle region

SUSD4 Peptide - middle region

Product Specifications

Product Name Alternative

N28096, AI848994, E430021N18Rik

UniProt

Q8BH32

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_659045.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LVLLLVILARMFQTKFKAHFPPRGPPRSSSSDPDFVVVDGVPVMLPTYDE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polystyrene A CHO
HA25031506.100G 100 g

Polystyrene A CHO

Sign In for Pricing
View Details
Diethyl Sulfide
TRC-D445005-1G 1 g

Diethyl Sulfide

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS629367 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
Human ELISA Kit
K055-H1 1 Plate

Human ELISA Kit

Sign In for Pricing
View Details
MLH1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D12]
TA810280AM 100 µL

MLH1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D12]

Sign In for Pricing
View Details
Gelsolin (GSN) (NM_000177) Human Recombinant Protein
TP314871M 100 µg

Gelsolin (GSN) (NM_000177) Human Recombinant Protein

Sign In for Pricing
View Details