Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SUSD4 Peptide - middle region

SUSD4 Peptide - middle region

Product Specifications

Product Name Alternative

N28096, AI848994, E430021N18Rik

UniProt

Q8BH32

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_659045.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LVLLLVILARMFQTKFKAHFPPRGPPRSSSSDPDFVVVDGVPVMLPTYDE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Smc1a Mouse Gene Knockout Kit (CRISPR)
KN516294 1 Kit

Smc1a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Isotype Control, Mouse IgG1 Kappa (IGG1/1331), CF405M Conjugate, 0.1 mg/mL
BNC051331-1ML 1x 1 mL

Isotype Control, Mouse IgG1 Kappa (IGG1/1331), CF405M Conjugate, 0.1 mg/mL

Sign In for Pricing
View Details
CD8B Mouse Monoclonal Antibody [Clone ID: EP42]
AM08123FC-N 500 µg

CD8B Mouse Monoclonal Antibody [Clone ID: EP42]

Sign In for Pricing
View Details
MAP4K3 (NM_003618) Human Over-expression Lysate
LY401198 100 µg

MAP4K3 (NM_003618) Human Over-expression Lysate

Sign In for Pricing
View Details
(2S)-2,6-Diamino-N-((2S)-1-hydroxy-1-phenylpropan-2-yl)hexanamide
TRC-D255630-25MG 25 mg

(2S)-2,6-Diamino-N-((2S)-1-hydroxy-1-phenylpropan-2-yl)hexanamide

Sign In for Pricing
View Details
GSTM4 Rabbit Polyclonal Antibody
TA362082 100 µL

GSTM4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details