Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FSCB Peptide - middle region

FSCB Peptide - middle region

Product Specifications

UniProt

Q4V7A4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RSQQTSCTGDWSLIYICPKEKVDKEQQTYFSELEIIIRSIPGSSMTKSKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Pde1a activation kit by CRISPRa
GA203141 1 Kit

Mouse Pde1a activation kit by CRISPRa

Sign In for Pricing
View Details
Serum Amyloid P / APCS (APCS/3240), CF640R conjugate, 0.1mg/mL
BNC403240-100 1x 100 µL

Serum Amyloid P / APCS (APCS/3240), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IL6 Mouse Monoclonal Antibody [Clone ID: 8E10]
AM26384PU-L 500 µg

IL6 Mouse Monoclonal Antibody [Clone ID: 8E10]

Sign In for Pricing
View Details
Cortisol 21-m-Sulfobenzoate Sodium Salt
TRC-C696335-10MG 10 mg

Cortisol 21-m-Sulfobenzoate Sodium Salt

Sign In for Pricing
View Details
Hemoglobin High Sensitivity Colorimetric Detection Kit
K013-HX5 10 Plates

Hemoglobin High Sensitivity Colorimetric Detection Kit

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS808167 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details