Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AP1G2 Peptide - middle region

AP1G2 Peptide - middle region

Product Specifications

Product Name Alternative

G2ad, Adtg2

UniProt

O88512

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_031481.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TLVTTGYSTEHSISGVSDPFLQVQILRLLRILGRNHEESSETMNDLLAQV

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLV3-U6-CD44-sgRNA2-Cas9-EGFP-Puro Plasmid
PVT76315 2 µg

PLV3-U6-CD44-sgRNA2-Cas9-EGFP-Puro Plasmid

Sign In for Pricing
View Details
Fam55d Antibody
GWB-MQ010A 50 µg

Fam55d Antibody

Sign In for Pricing
View Details
PTP1C Antibody
GWB-6DE87E 0.1 mg

PTP1C Antibody

Sign In for Pricing
View Details
Human RAB30 siRNA
abx930639-01 15 nmol

Human RAB30 siRNA

Sign In for Pricing
View Details
Human RAB30 siRNA
abx930639-02 30 nmol

Human RAB30 siRNA

Sign In for Pricing
View Details
PACSIN3 (NM_016223) Human Tagged ORF Clone Lentiviral Particle
RC204103L4V 200 µL

PACSIN3 (NM_016223) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details