Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AP1G2 Peptide - middle region

AP1G2 Peptide - middle region

Product Specifications

Product Name Alternative

G2ad, Adtg2

UniProt

O88512

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_031481.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TLVTTGYSTEHSISGVSDPFLQVQILRLLRILGRNHEESSETMNDLLAQV

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ptpn14 Mouse siRNA Oligo Duplex (Locus ID 19250)
SR422350 1 Kit

Ptpn14 Mouse siRNA Oligo Duplex (Locus ID 19250)

Sign In for Pricing
View Details
5-Ethylpyridine-3-boronic acid
OR360079-01 100 mg

5-Ethylpyridine-3-boronic acid

Sign In for Pricing
View Details
5-Ethylpyridine-3-boronic acid
OR360079-02 250 mg

5-Ethylpyridine-3-boronic acid

Sign In for Pricing
View Details
5-Ethylpyridine-3-boronic acid
OR360079-03 1 g

5-Ethylpyridine-3-boronic acid

Sign In for Pricing
View Details
5-Ethylpyridine-3-boronic acid
OR360079-04 5 g

5-Ethylpyridine-3-boronic acid

Sign In for Pricing
View Details
5-Ethylpyridine-3-boronic acid
OR360079-05 10 g

5-Ethylpyridine-3-boronic acid

Sign In for Pricing
View Details