What is the catalog number for TOMT Peptide - middle region?

The catalog number for TOMT Peptide - middle region is orb1998126.

What sizes are available for TOMT Peptide - middle region?

TOMT Peptide - middle region is available in the following size(s): 100 µg.

Is TOMT Peptide - middle region in stock?

TOMT Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

TOMT Peptide - middle region

Product Specifications

Product Name Alternative

Comt2, F930017I19Rik

UniProt

B6CZ62

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001075148.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FSYVLTHALPGDPGHILTTLDHWSSCCEYLSHMGPVKGQILMRLVEEKAP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBP2-81881AF700 0.1 mL

Rabbit Polyclonal PPM1D Antibody [Alexa Fluor 700]

Sign In for Pricing

View Details

ERTH0226 96 Tests

Rabbit Hb-AGE ELISA Kit

Sign In for Pricing

View Details

GTR15415594 1 Vial

Human DDX41 Knockout A549 cell line

Sign In for Pricing

View Details

EH20881 96 Tests

Human MMP-7 (Matrix Metalloproteinase 7) ELISA Kit

Sign In for Pricing

View Details

NB500-186F 0.1 mL

Rabbit Polyclonal CCAR1 Antibody [FITC]

Sign In for Pricing

View Details

sc-62602-SH 20 µg

MAST205 shRNA Plasmid (h)

Sign In for Pricing

View Details