What is the catalog number for TOMT Peptide - middle region?

The catalog number for TOMT Peptide - middle region is orb1998126.

What sizes are available for TOMT Peptide - middle region?

TOMT Peptide - middle region is available in the following size(s): 100 µg.

Is TOMT Peptide - middle region in stock?

TOMT Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

TOMT Peptide - middle region

Product Specifications

Product Name Alternative

Comt2, F930017I19Rik

UniProt

B6CZ62

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001075148.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FSYVLTHALPGDPGHILTTLDHWSSCCEYLSHMGPVKGQILMRLVEEKAP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

bs-20351R-Cy5-TR 20 µL

Bcl-2 Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing

View Details

NB100-237UV 0.1 mL

Rabbit Polyclonal SERCA2 ATPase Antibody [DyLight 350]

Sign In for Pricing

View Details

orb1952331-01 48 Tests

Human Poly ADP Ribose Polymerase (PARP) ELISA Kit

Sign In for Pricing

View Details

orb1952331-02 96 Tests

Human Poly ADP Ribose Polymerase (PARP) ELISA Kit

Sign In for Pricing

View Details

APRab16366-01 20 µL

POM121 Rabbit Polyclonal Antibody

Sign In for Pricing

View Details

APRab16366-02 50 µL

POM121 Rabbit Polyclonal Antibody

Sign In for Pricing

View Details