MAP7D2 Peptide - N-terminal region
MAP7D2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
Mtap7d2, 1600028E09Rik, 2900002G04Rik, 5330432J06Rik, C030036K04Rik
UniProt
A2AG50
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001074593.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EKQKRAKLQYEKQIEERWRKLEEQRQREDQKRAAVEEKRKQKLREEEERL
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15239472 1 Vial
Lentiviral mouse Zfp518a shRNA (UAS) - Lentiviral mouse Zfp518a shRNA (UAS, RFP) (100)
Sign In for Pricing
View Details T9697 1x106 cells / 1.0 mL
SLC35A2 CRISPR Knock Out HEK293T Stable Cell Line (Human) T2-43
Sign In for Pricing
View Details 
D6627 96 Tests
GDP-fucose protein O-fucosyltransferase 1 (POFUT1) Human ELISA Kit
Sign In for Pricing
View Details 