Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRRC47 Peptide - middle region

LRRC47 Peptide - middle region

Product Specifications

Product Name Alternative

AA960559, mKIAA1185, 2900010D03Rik

UniProt

Q505F5

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_957678.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KELVRQLQLEAEEQRKQKKRQSVSGLHRYLHLLDGKENYPCLVDAEGDVI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uncoated Human sTREM-1 (soluble Triggering Receptor Expressed on Myeloid Cells-1) ELISA Kit
E-UNEL-H0200-01 5x 96 Tests

Uncoated Human sTREM-1 (soluble Triggering Receptor Expressed on Myeloid Cells-1) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human sTREM-1 (soluble Triggering Receptor Expressed on Myeloid Cells-1) ELISA Kit
E-UNEL-H0200-02 15x 96 Tests

Uncoated Human sTREM-1 (soluble Triggering Receptor Expressed on Myeloid Cells-1) ELISA Kit

Sign In for Pricing
View Details
CDY2B (NM_001001722) Human Over-expression Lysate
LC424221 20 µg

CDY2B (NM_001001722) Human Over-expression Lysate

Sign In for Pricing
View Details
Human RTF2 activation kit by CRISPRa
GA109842 1 Kit

Human RTF2 activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Endometrium
CS631074 5x 5 µm

Frozen Tissue Sections, Endometrium

Sign In for Pricing
View Details
NPTXR (NM_014293) Human Recombinant Protein
TP701091 50 µg

NPTXR (NM_014293) Human Recombinant Protein

Sign In for Pricing
View Details