Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRRC47 Peptide - middle region

LRRC47 Peptide - middle region

Product Specifications

Product Name Alternative

AA960559, mKIAA1185, 2900010D03Rik

UniProt

Q505F5

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_957678.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KELVRQLQLEAEEQRKQKKRQSVSGLHRYLHLLDGKENYPCLVDAEGDVI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Closed Cup Flash Point Tester BPTL-207
BPTL-207 1 Unit

Closed Cup Flash Point Tester BPTL-207

Sign In for Pricing
View Details
Tal1 (TAL1/3146), CF740 conjugate, 0.1mg/mL
BNC743146-500 1x 500 µL

Tal1 (TAL1/3146), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Sodium Borohydride-d4
TRC-S614902-5G 5 g

Sodium Borohydride-d4

Sign In for Pricing
View Details
Avibactam Sodium Salt
TRC-A794850-5MG 5 mg

Avibactam Sodium Salt

Sign In for Pricing
View Details
Human Kindlin (FERMT1) activation kit by CRISPRa
GA110822 1 Kit

Human Kindlin (FERMT1) activation kit by CRISPRa

Sign In for Pricing
View Details
NF2 pSer518 Rabbit Polyclonal Antibody
AP02513PU-S 50 µL

NF2 pSer518 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details