FRMD8 Peptide - middle region
FRMD8 Peptide - middle region
Product Specifications
Product Name Alternative
AU018809, 1200004M23Rik, 2310035N23Rik, 4931429L16Rik
UniProt
Q3UFK8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_080445.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RAVREVLQLPDVALEAFALWLVSPLLEVQLKPKHQPYKLGRQWPELLLRF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb1881937-01 20 µg
Recombinant Saccharomyces cerevisiae Actin-related protein 5 (ARP5), partial
Sign In for Pricing
View Details orb1881937-02 100 µg
Recombinant Saccharomyces cerevisiae Actin-related protein 5 (ARP5), partial
Sign In for Pricing
View Details orb1881937-03 1 mg
Recombinant Saccharomyces cerevisiae Actin-related protein 5 (ARP5), partial
Sign In for Pricing
View Details MBS2133249-01 0.1 mL
HRP Linked Polyclonal Antibody to Tumor Necrosis Factor Receptor Superfamily, Member 4 (TNFRSF4)
Sign In for Pricing
View Details MBS2133249-02 0.2 mL
HRP Linked Polyclonal Antibody to Tumor Necrosis Factor Receptor Superfamily, Member 4 (TNFRSF4)
Sign In for Pricing
View Details MBS2133249-03 0.5 mL
HRP Linked Polyclonal Antibody to Tumor Necrosis Factor Receptor Superfamily, Member 4 (TNFRSF4)
Sign In for Pricing
View Details