Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OTOL1 Peptide - C-terminal region

OTOL1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Gm414

UniProt

Q4ZJM7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001018041.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SLVARNRKQFKSRETLYGQQVDQASLLLILKLSAGDQVWLEVSKDWNGLY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BRCA1 (Breast Marker) (BRCA1/1472), CF740 conjugate, 0.1mg/mL
BNC741472-500 1x 500 µL

BRCA1 (Breast Marker) (BRCA1/1472), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EcoRV, 50 preps
FDRE1262 50 Preparations

EcoRV, 50 preps

Sign In for Pricing
View Details
TTF-1 / NKX2.1 (NX2.1/690), CF647 conjugate, 0.1mg/mL
BNC470690-100 1x 100 µL

TTF-1 / NKX2.1 (NX2.1/690), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Alkaline Phosphatase Conjugated Phytolacca americana Lectin (Pokeweed) -PWMPWA-
LA-1901-1 1 mg

Alkaline Phosphatase Conjugated Phytolacca americana Lectin (Pokeweed) -PWMPWA-

Sign In for Pricing
View Details
Human C6orf52 activation kit by CRISPRa
GA117666 1 Kit

Human C6orf52 activation kit by CRISPRa

Sign In for Pricing
View Details
Human ELAVL4 activation kit by CRISPRa
GA101382 1 Kit

Human ELAVL4 activation kit by CRISPRa

Sign In for Pricing
View Details