Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OTOL1 Peptide - C-terminal region

OTOL1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Gm414

UniProt

Q4ZJM7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001018041.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SLVARNRKQFKSRETLYGQQVDQASLLLILKLSAGDQVWLEVSKDWNGLY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyanine 3.5 monosuccinimidyl ester [equivalent to Cy3.5® NHS ester]
148-AAT 1 mg

Cyanine 3.5 monosuccinimidyl ester [equivalent to Cy3.5® NHS ester]

Sign In for Pricing
View Details
Arhgap21 Mouse Gene Knockout Kit (CRISPR)
KN501495 1 Kit

Arhgap21 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SMYD3 (NM_022743) Human Recombinant Protein
TP305933 20 µg

SMYD3 (NM_022743) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary
CS705372 5x 5 µm

Tissue FFPE Sections, Ovary

Sign In for Pricing
View Details
AP2B1 (NM_001282) Human Over-expression Lysate
LY420031 100 µg

AP2B1 (NM_001282) Human Over-expression Lysate

Sign In for Pricing
View Details
GALR3 (C-term) Rabbit Polyclonal Antibody
AP51778PU-N 400 µL

GALR3 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details