Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OTOP3 Peptide - N-terminal region

OTOP3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2310011E08Rik

UniProt

Q80UF9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

XP_006534179.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SLLLRRDRQAQKAGQLFSGLLALNVVFLGGAFICSMIFNKVSVTLGDVWI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (C8/1035), CF405S conjugate, 0.1mg/mL
BNC041035-100 1x 100 µL

CD8 (C8/1035), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF640R conjugate, 0.1mg/mL
BNC400322-100 1x 100 µL

CD3e (RIV9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD14 (Monocyte / Macrophage Marker) (LPSR/2408), CF594 conjugate, 0.1mg/mL
BNC942408-500 1x 500 µL

CD14 (Monocyte / Macrophage Marker) (LPSR/2408), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
VEGI (Vascular Endothelial Growth Inhibitor) (VEGI/1283), CF568 conjugate, 0.1mg/mL
BNC681283-100 1x 100 µL

VEGI (Vascular Endothelial Growth Inhibitor) (VEGI/1283), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG4 (Ig Heavy Constant Gamma 4) (G4m Marker) (IGHG4/2042R), CF405S conjugate, 0.1mg/mL
BNC042042-500 1x 500 µL

Human IgG4 (Ig Heavy Constant Gamma 4) (G4m Marker) (IGHG4/2042R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Adipophilin / Perilipin-2 (Marker of Obesity) (ADFP/1366), CF740 conjugate, 0.1mg/mL
BNC741366-100 1x 100 µL

Adipophilin / Perilipin-2 (Marker of Obesity) (ADFP/1366), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details