Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPRED3 Peptide - middle region

SPRED3 Peptide - middle region

Product Specifications

Product Name Alternative

Spred-3, AW047143, D130060H24Rik

UniProt

Q6P6N5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_891557.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HVDSDSSSSHSRQETPPTAPIATVESAAAFPLATRPQRRRSSAQSYPPLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLAIN1 (NM_144595) Human Untagged Clone
SC120744 10 µg

SLAIN1 (NM_144595) Human Untagged Clone

Sign In for Pricing
View Details
Anti-AIV HA1-C
Y123210 100 µL

Anti-AIV HA1-C

Sign In for Pricing
View Details
IGFBP3 (NM_001013398) Human Recombinant Protein
E45H30401E1 50 µg

IGFBP3 (NM_001013398) Human Recombinant Protein

Sign In for Pricing
View Details
1700056E22Rik ORF Vector (Mouse) (pORF)
ORF036822 1.0 µg DNA

1700056E22Rik ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
CREG1 peptide
orb218892-01 1 mg

CREG1 peptide

Sign In for Pricing
View Details
CREG1 peptide
orb218892-02 5 mg

CREG1 peptide

Sign In for Pricing
View Details