Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPRED3 Peptide - middle region

SPRED3 Peptide - middle region

Product Specifications

Product Name Alternative

Spred-3, AW047143, D130060H24Rik

UniProt

Q6P6N5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_891557.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HVDSDSSSSHSRQETPPTAPIATVESAAAFPLATRPQRRRSSAQSYPPLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cathepsin H Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2497447 100 µL

Cathepsin H Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
Recombinant Human MMP 8 Protein, His, E.coli-5ug
QP12706-5ug 5ug

Recombinant Human MMP 8 Protein, His, E.coli-5ug

Sign In for Pricing
View Details
CDH5 antibody
70R-36391 100 ug

CDH5 antibody

Sign In for Pricing
View Details
Guinea pig Tenascin X ELISA Kit
MBS727093-01 48 Well

Guinea pig Tenascin X ELISA Kit

Sign In for Pricing
View Details
Guinea pig Tenascin X ELISA Kit
MBS727093-02 96 Well

Guinea pig Tenascin X ELISA Kit

Sign In for Pricing
View Details
Guinea pig Tenascin X ELISA Kit
MBS727093-03 5x 96 Well

Guinea pig Tenascin X ELISA Kit

Sign In for Pricing
View Details