Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FPR-RS7 Peptide - C-terminal region

FPR-RS7 Peptide - C-terminal region

Product Specifications

UniProt

Q71MR7

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SFNSCLNPILYVFLGQQFRERLIYSLSASLERALREDSALNSDKIRNLSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGF-beta (1D11.16.8), CF594 conjugate, 0.1mg/mL
BNC940977-100 1x 100 µL

TGF-beta (1D11.16.8), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF640R conjugate, 0.1mg/mL
BNC402848-100 1x 100 µL

Fibronectin (Fn-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (E29), CF488A conjugate, 0.1mg/mL
BNC880478-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (E29), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (DCS-60.2), CF647 conjugate, 0.1mg/mL
BNC470822-100 1x 100 µL

P21 / WAF1 (DCS-60.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF568 conjugate, 0.1mg/mL
BNC680270-100 1x 100 µL

Fibronectin (HFN7.1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cyclin B1 (CCNB1/1098), CF740 conjugate, 0.1mg/mL
BNC741098-100 1x 100 µL

Cyclin B1 (CCNB1/1098), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details