Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC71 Peptide - N-terminal region

CCDC71 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2600016J21Rik

UniProt

Q8VEG0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_598505.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VAFLQGLRDDGFQPTILRSGDVYGYSSCTASPPSQTKLQARTINPPATSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CRYBA2 Protein Vector (Human) (pPB-C-His)
PV010797 500 ng

CRYBA2 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Zbtb39 Mouse shRNA Plasmid (Locus ID 320080)
TL508288 1 Kit

Zbtb39 Mouse shRNA Plasmid (Locus ID 320080)

Sign In for Pricing
View Details
RN5S173 Adenovirus (Human)
39733051 1.0 mL

RN5S173 Adenovirus (Human)

Sign In for Pricing
View Details
ANKRD18B, NT (ANKRD18B, Ankyrin repeat domain-containing protein 18B) (MaxLight 490)
MBS6273582-01 0.1 mL

ANKRD18B, NT (ANKRD18B, Ankyrin repeat domain-containing protein 18B) (MaxLight 490)

Sign In for Pricing
View Details
ANKRD18B, NT (ANKRD18B, Ankyrin repeat domain-containing protein 18B) (MaxLight 490)
MBS6273582-02 5x 0.1 mL

ANKRD18B, NT (ANKRD18B, Ankyrin repeat domain-containing protein 18B) (MaxLight 490)

Sign In for Pricing
View Details
Recombinant Human Cadherin-12
MBS1265361-01 0.02 mg

Recombinant Human Cadherin-12

Sign In for Pricing
View Details