CCDC71 Peptide - N-terminal region
CCDC71 Peptide - N-terminal region
Product Specifications
Product Name Alternative
2600016J21Rik
UniProt
Q8VEG0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_598505.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VAFLQGLRDDGFQPTILRSGDVYGYSSCTASPPSQTKLQARTINPPATSL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6345370-01 0.2 mL
SCN5A, NT (SCN5A, Sodium channel protein type 5 subunit alpha, HH1, Sodium channel protein cardiac muscle subunit alpha, Sodium channel protein type V subunit alpha, Voltage-gated sodium channel subunit alpha Nav1.5) (PE)
Sign In for Pricing
View Details MBS6345370-02 5x 0.2 mL
SCN5A, NT (SCN5A, Sodium channel protein type 5 subunit alpha, HH1, Sodium channel protein cardiac muscle subunit alpha, Sodium channel protein type V subunit alpha, Voltage-gated sodium channel subunit alpha Nav1.5) (PE)
Sign In for Pricing
View Details 