Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VSTM2B Peptide - middle region

VSTM2B Peptide - middle region

Product Specifications

Product Name Alternative

AB030198, 2900093B09Rik

UniProt

Q9JME9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_067362.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SHRLRLSAVRLQDEGVYECRVSDYSDDDTQEHKAQALLRVLSRFAPPNMQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp618 Mouse Gene Knockout Kit (CRISPR)
KN519909 1 Kit

Zfp618 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
4-Dehydroxy-4-chloro Penciclovir
TRC-D230245-50MG 50 mg

4-Dehydroxy-4-chloro Penciclovir

Sign In for Pricing
View Details
Recombinant MEF2C Antibody
RC-15706-01 50 μL

Recombinant MEF2C Antibody

Sign In for Pricing
View Details
Recombinant MEF2C Antibody
RC-15706-02 100 µL

Recombinant MEF2C Antibody

Sign In for Pricing
View Details
Recombinant MEF2C Antibody
RC-15706-03 1 mL

Recombinant MEF2C Antibody

Sign In for Pricing
View Details
Amyloid beta (1-14) Rabbit Polyclonal Antibody
AP09220PU-N 100 µg

Amyloid beta (1-14) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details