Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VSTM2B Peptide - middle region

VSTM2B Peptide - middle region

Product Specifications

Product Name Alternative

AB030198, 2900093B09Rik

UniProt

Q9JME9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_067362.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SHRLRLSAVRLQDEGVYECRVSDYSDDDTQEHKAQALLRVLSRFAPPNMQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPRED2 Antibody
KC-14091-01 50 μL

SPRED2 Antibody

Sign In for Pricing
View Details
SPRED2 Antibody
KC-14091-02 100 µL

SPRED2 Antibody

Sign In for Pricing
View Details
SPRED2 Antibody
KC-14091-03 1 mL

SPRED2 Antibody

Sign In for Pricing
View Details
2,4-Dichloropyrimidine
TRC-D435845-25G 25 g

2,4-Dichloropyrimidine

Sign In for Pricing
View Details
FAM3A (NM_021806) Human Recombinant Protein
TP303495 20 µg

FAM3A (NM_021806) Human Recombinant Protein

Sign In for Pricing
View Details
Ataxin 3 (ATXN3) (NM_001164781) Human Over-expression Lysate
LC431255 20 µg

Ataxin 3 (ATXN3) (NM_001164781) Human Over-expression Lysate

Sign In for Pricing
View Details