Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

9530077C05RIK Peptide - middle region

9530077C05RIK Peptide - middle region

Product Specifications

Product Name Alternative

MKIAA0895, 1110003N12Rik

UniProt

Q7TQE7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_081015.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GINNLQQPWNSWIGRKKHELKPNNPTEEGLASIHSVLFRKDPFLWRAALL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® Violet 450 Anti-Human CD19 Antibody[SJ25C1]
AN00334Q-01 20 Tests

Elab Fluor® Violet 450 Anti-Human CD19 Antibody[SJ25C1]

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Human CD19 Antibody[SJ25C1]
AN00334Q-02 100 Tests

Elab Fluor® Violet 450 Anti-Human CD19 Antibody[SJ25C1]

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Human CD19 Antibody[SJ25C1]
AN00334Q-03 2x 100 Tests

Elab Fluor® Violet 450 Anti-Human CD19 Antibody[SJ25C1]

Sign In for Pricing
View Details
Anti-Sortilin (Neurotensin receptor 3)
Y051715 50 μL

Anti-Sortilin (Neurotensin receptor 3)

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS501502 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Colloidal Gold Labeled Alkaline Phosphatase, 1mL 10nm
GE-03-10 1 mL

Colloidal Gold Labeled Alkaline Phosphatase, 1mL 10nm

Sign In for Pricing
View Details