Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

9530077C05RIK Peptide - middle region

9530077C05RIK Peptide - middle region

Product Specifications

Product Name Alternative

MKIAA0895, 1110003N12Rik

UniProt

Q7TQE7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_081015.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GINNLQQPWNSWIGRKKHELKPNNPTEEGLASIHSVLFRKDPFLWRAALL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Microscope Slides
M7100-45 72 Units/Pack

Microscope Slides

Sign In for Pricing
View Details
EGFR (GFR450), 0.2mg/mL
BNUB0450-500 1x 500 µL

EGFR (GFR450), 0.2mg/mL

Sign In for Pricing
View Details
MIR4746 Human qPCR Primer Pair (MI0017385)
HP301132 200 Reactions

MIR4746 Human qPCR Primer Pair (MI0017385)

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: left
CS629594 5x 5 µm

Frozen Tissue Sections, Ovary: left

Sign In for Pricing
View Details
1-Acetamidonaphthalene
TRC-A158455-2G 2 g

1-Acetamidonaphthalene

Sign In for Pricing
View Details
TEM7 (PLXDC1) (NM_020405) Human Over-expression Lysate
LC402784 20 µg

TEM7 (PLXDC1) (NM_020405) Human Over-expression Lysate

Sign In for Pricing
View Details