Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABHD17A Peptide - middle region

ABHD17A Peptide - middle region

Product Specifications

Product Name Alternative

Fam108a, upf0227, Fam108a1, RGD1359682

UniProt

Q5XIJ5

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001006984

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GNAVDLGQMCSFYVGLGTRIGCNIFSYDYSGYGISSGRPSEKNLYADIDAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Lung
CS706524 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
GP2 (Glycoprotein 2) / ZAP75 (GP2/1803), 1mg/mL
BNUM1803-50 1x 50 µL

GP2 (Glycoprotein 2) / ZAP75 (GP2/1803), 1mg/mL

Sign In for Pricing
View Details
VPAC2 (VIPR2) (NM_003382) Human Recombinant Protein
TP303761M 100 µg

VPAC2 (VIPR2) (NM_003382) Human Recombinant Protein

Sign In for Pricing
View Details
BHMT Mouse Monoclonal Antibody [Clone ID: 3D6]
AM50001PU-S 50 µL

BHMT Mouse Monoclonal Antibody [Clone ID: 3D6]

Sign In for Pricing
View Details
QuicKey Pro Rabbit Pg (Progesterone) ELISA Kit
E-OSEL-RB0003-01 24 Tests

QuicKey Pro Rabbit Pg (Progesterone) ELISA Kit

Sign In for Pricing
View Details
QuicKey Pro Rabbit Pg (Progesterone) ELISA Kit
E-OSEL-RB0003-02 48 Tests

QuicKey Pro Rabbit Pg (Progesterone) ELISA Kit

Sign In for Pricing
View Details