Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABHD17A Peptide - middle region

ABHD17A Peptide - middle region

Product Specifications

Product Name Alternative

Fam108a, upf0227, Fam108a1, RGD1359682

UniProt

Q5XIJ5

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001006984

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GNAVDLGQMCSFYVGLGTRIGCNIFSYDYSGYGISSGRPSEKNLYADIDAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLVS2 (NM_001010852) Human Over-expression Lysate
LY423183 100 µg

CLVS2 (NM_001010852) Human Over-expression Lysate

Sign In for Pricing
View Details
Nucleophosmin (Acute Myeloid Leukemia Marker) (NPM1/3285), CF740 conjugate, 0.1mg/mL
BNC743285-500 1x 500 µL

Nucleophosmin (Acute Myeloid Leukemia Marker) (NPM1/3285), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MMP3 Mouse Monoclonal Antibody [Clone ID: 1B4]
AM05378PU-N 200 µg

MMP3 Mouse Monoclonal Antibody [Clone ID: 1B4]

Sign In for Pricing
View Details
ZNF425 Human Gene Knockout Kit (CRISPR)
KN420017 1 Kit

ZNF425 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
OR4A5 Human Gene Knockout Kit (CRISPR)
KN416013 1 Kit

OR4A5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
14,15-Epoxy-moxidectin (>85%)
TRC-E589243-50MG 50 mg

14,15-Epoxy-moxidectin (>85%)

Sign In for Pricing
View Details