Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

A2M Peptide - middle region

A2M Peptide - middle region

Product Specifications

Product Name Alternative

A2mp

UniProt

P06238

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_783327.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TGYQRQLNYKHRDGSYSTFGDKPGRSHANTWLTAFVLKSFAQARRYIFID

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Carbonic Anhydrase 9/CA9 Antibody Picoband® (Biotine Conjugate)
A01083-3-Biotin 100 µg/Vial

Anti-Carbonic Anhydrase 9/CA9 Antibody Picoband® (Biotine Conjugate)

Sign In for Pricing
View Details
(E/Z) -MC4
HY-129487-01 5 mg

(E/Z) -MC4

Sign In for Pricing
View Details
(E/Z) -MC4
HY-129487-02 10 mg

(E/Z) -MC4

Sign In for Pricing
View Details
(E/Z) -MC4
HY-129487-03 25 mg

(E/Z) -MC4

Sign In for Pricing
View Details
(E/Z) -MC4
HY-129487-04 50 mg

(E/Z) -MC4

Sign In for Pricing
View Details
(E/Z) -MC4
HY-129487-05 100 mg

(E/Z) -MC4

Sign In for Pricing
View Details