Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

A2M Peptide - middle region

A2M Peptide - middle region

Product Specifications

Product Name Alternative

A2mp

UniProt

P06238

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_783327.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TGYQRQLNYKHRDGSYSTFGDKPGRSHANTWLTAFVLKSFAQARRYIFID

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-4327 miRNA Antagomir
orb1915260-01 10 nmol

Hsa-miR-4327 miRNA Antagomir

Sign In for Pricing
View Details
Hsa-miR-4327 miRNA Antagomir
orb1915260-02 20 nmol

Hsa-miR-4327 miRNA Antagomir

Sign In for Pricing
View Details
TMPRSS12 CRISPR Activation Plasmid (m)
sc-429007-ACT 20 µg

TMPRSS12 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
PDI (C-2) Alexa Fluor® 594
sc-74551 AF594 200 µg/mL

PDI (C-2) Alexa Fluor® 594

Sign In for Pricing
View Details
Recombinant Secretory Component Glycoprotein Antibody / ECM1
orb2641667 100 µg

Recombinant Secretory Component Glycoprotein Antibody / ECM1

Sign In for Pricing
View Details
Human C11orf58 knockout cell line
ABC-KH1675 1 Vial

Human C11orf58 knockout cell line

Sign In for Pricing
View Details