CCDC89 Peptide - C-terminal region
CCDC89 Peptide - C-terminal region
Product Specifications
Product Name Alternative
BOIP, AU022100, 1700019B01Rik
UniProt
Q9DA73
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_081574.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AVDSNLRVRELQRRVDGIQKAYDELRLQSEAFKKHSLDLLSKERELNAKL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1570403-01 0.1 mg
Anti-Aspergillus niger GOD/gox/Glucose oxidase Antibody (BC8)
Sign In for Pricing
View Details MBS1570403-02 1 mg
Anti-Aspergillus niger GOD/gox/Glucose oxidase Antibody (BC8)
Sign In for Pricing
View Details MBS1570403-03 5x 1 mg
Anti-Aspergillus niger GOD/gox/Glucose oxidase Antibody (BC8)
Sign In for Pricing
View Details