What is the catalog number for CCDC89 Peptide - C-terminal region?

The catalog number for CCDC89 Peptide - C-terminal region is orb1998101.

What sizes are available for CCDC89 Peptide - C-terminal region?

CCDC89 Peptide - C-terminal region is available in the following size(s): 100 µg.

Is CCDC89 Peptide - C-terminal region in stock?

CCDC89 Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

CCDC89 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BOIP, AU022100, 1700019B01Rik

UniProt

Q9DA73

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_081574.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AVDSNLRVRELQRRVDGIQKAYDELRLQSEAFKKHSLDLLSKERELNAKL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MBS103744 Inquire

Goose Carnitine Palmitoyltransferase 1B, Muscle ELISA Kit

Sign In for Pricing

View Details

T73753-01 5 mg

Neuraminic acid

Sign In for Pricing

View Details

T73753-02 50 mg

Neuraminic acid

Sign In for Pricing

View Details

NBP3-20886JF585 0.1 mL

Mouse Monoclonal Cadherin-16 Antibody (rCDH16/7342) [Janelia Fluor 585]

Sign In for Pricing

View Details

TU159935 1.0 mL

Ifng 3'UTR GFP Stable Cell Line

Sign In for Pricing

View Details

NBP2-68494PCP 0.5 mL

Goat Polyclonal Goat anti-Rat IgM (H+L) Secondary Antibody [PerCP]

Sign In for Pricing

View Details