Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC83 Peptide - middle region

CCDC83 Peptide - middle region

Product Specifications

Product Name Alternative

4930549K11Rik, 4930554C01Rik, 4932423M01Rik

UniProt

Q9D4V3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_083532.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FERQQEASLKEMRIQINEAEKLFLEKLSEKEYWEEYKNVGSAQHAQLIVS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Claudin 11 Antibody
MBS8511994-01 0.05 mg

Claudin 11 Antibody

Sign In for Pricing
View Details
Claudin 11 Antibody
MBS8511994-02 0.1 mg

Claudin 11 Antibody

Sign In for Pricing
View Details
Claudin 11 Antibody
MBS8511994-03 0.1 mL (AF750)

Claudin 11 Antibody

Sign In for Pricing
View Details
Claudin 11 Antibody
MBS8511994-04 0.1 mL (AF405M)

Claudin 11 Antibody

Sign In for Pricing
View Details
Claudin 11 Antibody
MBS8511994-05 0.1 mL (AF546)

Claudin 11 Antibody

Sign In for Pricing
View Details
Claudin 11 Antibody
MBS8511994-06 0.1 mL (AF405L)

Claudin 11 Antibody

Sign In for Pricing
View Details