Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SYCE1L Peptide - middle region

SYCE1L Peptide - middle region

Product Specifications

Product Name Alternative

MMRP, PSESS, mmrp2, 4930481F22Rik

UniProt

Q5D525

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001041610.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KAEDTRGQAASLNTMEDLLETVKKLQKEGSLEPQIEDLIHRINELQQGPA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glucose Regulated Protein 94 (GRP94) (HSP90B1/1192), CF405S conjugate, 0.1mg/mL
BNC041192-100 1x 100 µL

Glucose Regulated Protein 94 (GRP94) (HSP90B1/1192), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
KAT2A (C-term) Rabbit Polyclonal Antibody
AP52039PU-N 400 µL

KAT2A (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Thyroglobulin (Thyroidal Cell Marker) (r6E1), CF647 conjugate, 0.1mg/mL
BNC471969-500 1x 500 µL

Thyroglobulin (Thyroidal Cell Marker) (r6E1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (KRT8/803 + KRT18/835), 0.2mg/mL
BNUB0979-100 1x 100 µL

Cytokeratin 8/18 (KRT8/803 + KRT18/835), 0.2mg/mL

Sign In for Pricing
View Details
YBX1 / Y-box Binding Protein 1 / YB-1 (Tumor Biomarker) (rYBX1/2430), 1mg/mL
BNUM2570-50 1x 50 µL

YBX1 / Y-box Binding Protein 1 / YB-1 (Tumor Biomarker) (rYBX1/2430), 1mg/mL

Sign In for Pricing
View Details
Slc7a9 Mouse Gene Knockout Kit (CRISPR)
KN516201 1 Kit

Slc7a9 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details