Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SYCE1L Peptide - middle region

SYCE1L Peptide - middle region

Product Specifications

Product Name Alternative

MMRP, PSESS, mmrp2, 4930481F22Rik

UniProt

Q5D525

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001041610.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KAEDTRGQAASLNTMEDLLETVKKLQKEGSLEPQIEDLIHRINELQQGPA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PXMP2 (NM_018663) Human Recombinant Protein
TP309935M 100 µg

PXMP2 (NM_018663) Human Recombinant Protein

Sign In for Pricing
View Details
OR10R2 Antibody
8G830-AAT 50 µg

OR10R2 Antibody

Sign In for Pricing
View Details
Bromoform
TRC-B687335-250ML 250 mL

Bromoform

Sign In for Pricing
View Details
Cofilin (Ab-3) Antibody
8B7047-AAT 50 µg

Cofilin (Ab-3) Antibody

Sign In for Pricing
View Details
Slc25a30 (BC022676) Mouse Tagged ORF Clone
MG202258 10 µg

Slc25a30 (BC022676) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
(6Alpha,11Beta)-6,9-Difluoro-11-hydroxypregna-1,4,16-triene-3,20-dione
TRC-D446105-1MG 1 mg

(6Alpha,11Beta)-6,9-Difluoro-11-hydroxypregna-1,4,16-triene-3,20-dione

Sign In for Pricing
View Details