Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM30C Peptide - N-terminal region

TMEM30C Peptide - N-terminal region

Product Specifications

Product Name Alternative

Cdc50c, 4933401B01Rik, 4933409A18Rik

UniProt

Q9D4D7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_081927.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LSRLPENTALKQQTLPTQQLNLSASVVLSIFFITGGFCLSIGIILLLSAK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TentaGel® S NPC
S30050.25G 25 g

TentaGel® S NPC

Sign In for Pricing
View Details
Human Cell Division Cycle Protein 42 (CDC42) ELISA Kit
RDR-CDC42-Hu-01 96 Tests

Human Cell Division Cycle Protein 42 (CDC42) ELISA Kit

Sign In for Pricing
View Details
Human Cell Division Cycle Protein 42 (CDC42) ELISA Kit
RDR-CDC42-Hu-02 48 Tests

Human Cell Division Cycle Protein 42 (CDC42) ELISA Kit

Sign In for Pricing
View Details
LC3B (MAP1LC3B) pThr12 Rabbit Polyclonal Antibody
AP32197PU-N 400 µL

LC3B (MAP1LC3B) pThr12 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ACRBP
Y058531 100 µL

ACRBP

Sign In for Pricing
View Details
Syntenin (SDCBP) (NM_001007068) Human Recombinant Protein
TP315442 20 µg

Syntenin (SDCBP) (NM_001007068) Human Recombinant Protein

Sign In for Pricing
View Details