Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM30C Peptide - N-terminal region

TMEM30C Peptide - N-terminal region

Product Specifications

Product Name Alternative

Cdc50c, 4933401B01Rik, 4933409A18Rik

UniProt

Q9D4D7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_081927.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LSRLPENTALKQQTLPTQQLNLSASVVLSIFFITGGFCLSIGIILLLSAK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Raja 42
TRC-R080000-250MG 250 mg

Raja 42

Sign In for Pricing
View Details
CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/2809R), CF594 conjugate, 0.1mg/mL
BNC942809-500 1x 500 µL

CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/2809R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GRAA Antibody
8C13058-AAT 50 µg

GRAA Antibody

Sign In for Pricing
View Details
2,2’-Dibenzothiazoyl Disulfide
TRC-D417020-250G 250 g

2,2’-Dibenzothiazoyl Disulfide

Sign In for Pricing
View Details
CF®488A Goat Anti-Mouse IgG3 (γ3), 2mg/mL
#20924-250uL 1x 250 µL

CF®488A Goat Anti-Mouse IgG3 (γ3), 2mg/mL

Sign In for Pricing
View Details
EMI1 (EMI1/1176), CF405S conjugate, 0.1mg/mL
BNC041176-100 1x 100 µL

EMI1 (EMI1/1176), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details