FBLL1 Peptide - C-terminal region
FBLL1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
AI595406
UniProt
P35550
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001004147.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ANCIDSTASAEAVFASEVRKLQQENLKPQEQLTLEPYERDHAVVVGVYRP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
247357-ML650 100 µL
ID1 (Inhibitor of DNA Binding 1, Dominant Negative Helix-loop-Helix Protein, ID, bHLHb24) (MaxLight 650)
Sign In for Pricing
View Details 
bs-6235R-BF405 100 µL
NRG3 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
Sign In for Pricing
View Details JL13703-01 48 Tests
Human Hepatitis C Virus Antibody (HCV-Ab) ELISA Kit
Sign In for Pricing
View Details JL13703-02 96 Tests
Human Hepatitis C Virus Antibody (HCV-Ab) ELISA Kit
Sign In for Pricing
View Details