What is the catalog number for FBLL1 Peptide - C-terminal region?

The catalog number for FBLL1 Peptide - C-terminal region is orb1998095.

What sizes are available for FBLL1 Peptide - C-terminal region?

FBLL1 Peptide - C-terminal region is available in the following size(s): 100 µg.

Is FBLL1 Peptide - C-terminal region in stock?

FBLL1 Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

FBLL1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AI595406

UniProt

P35550

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001004147.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ANCIDSTASAEAVFASEVRKLQQENLKPQEQLTLEPYERDHAVVVGVYRP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RD22340F-01 25 µg

PE/Cyanine5 Mouse IgM, κ Isotype Control

Sign In for Pricing

View Details

RD22340F-02 100 µg

PE/Cyanine5 Mouse IgM, κ Isotype Control

Sign In for Pricing

View Details

NBP1-78427AF532 0.1 mL

Rabbit Polyclonal TLR4 Antibody [Alexa Fluor 532]

Sign In for Pricing

View Details

HY-P75294-01 5 µg

Delta-like 4/DLL4, Human (HEK293, Fc)

Sign In for Pricing

View Details

HY-P75294-02 10 µg

Delta-like 4/DLL4, Human (HEK293, Fc)

Sign In for Pricing

View Details

HY-P75294-03 50 µg

Delta-like 4/DLL4, Human (HEK293, Fc)

Sign In for Pricing

View Details